Lineage for d1xgsb1 (1xgs B:195-271)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149792Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 150081Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (35 families) (S)
  5. 150382Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein)
  6. 150383Protein Methionine aminopeptidase, insert domain [46888] (2 species)
  7. 150384Species Archaeon Pyrococcus furiosus [TaxId:2261] [46889] (4 PDB entries)
  8. 150386Domain d1xgsb1: 1xgs B:195-271 [16217]
    Other proteins in same PDB: d1xgsa2, d1xgsb2

Details for d1xgsb1

PDB Entry: 1xgs (more details), 1.75 Å

PDB Description: methionine aminopeptidase from hyperthermophile pyrococcus furiosus

SCOP Domain Sequences for d1xgsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xgsb1 a.4.5.25 (B:195-271) Methionine aminopeptidase, insert domain {Archaeon Pyrococcus furiosus}
gqvievpptliymyvrdvpvrvaqarfllakikreygtlpfayrwlqndmpegqlklalk
tlekagaiygypvlkei

SCOP Domain Coordinates for d1xgsb1:

Click to download the PDB-style file with coordinates for d1xgsb1.
(The format of our PDB-style files is described here.)

Timeline for d1xgsb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xgsb2