Lineage for d1c0wa1 (1c0w A:2-64)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438531Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families) (S)
    contains a small beta-sheet (wing)
  5. 438851Family a.4.5.24: Iron-dependent repressor protein [46882] (3 proteins)
  6. 438852Protein Diphtheria toxin repressor (DtxR) [46883] (1 species)
  7. 438853Species Corynebacterium diphtheriae [TaxId:1717] [46884] (16 PDB entries)
  8. 438879Domain d1c0wa1: 1c0w A:2-64 [16211]
    Other proteins in same PDB: d1c0wa2, d1c0wa3, d1c0wb2, d1c0wb3, d1c0wc2, d1c0wc3, d1c0wd2, d1c0wd3

Details for d1c0wa1

PDB Entry: 1c0w (more details), 3.2 Å

PDB Description: crystal structure of the cobalt-activated diphtheria toxin repressor-dna complex reveals a metal binding sh-like domain

SCOP Domain Sequences for d1c0wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0wa1 a.4.5.24 (A:2-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
kdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrs
lqm

SCOP Domain Coordinates for d1c0wa1:

Click to download the PDB-style file with coordinates for d1c0wa1.
(The format of our PDB-style files is described here.)

Timeline for d1c0wa1: