SCOP 1.71: Domain d1c0wa1: 1c0w A:2-64

Lineage for d1c0wa1 (1c0w A:2-64)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (61 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.24: Iron-dependent repressor protein [46882] (3 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [46883] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [46884] (16 PDB entries)

8. Domain d1c0wa1: 1c0w A:2-64 [16211]
   Other proteins in same PDB: d1c0wa2, d1c0wa3, d1c0wb2, d1c0wb3, d1c0wc2, d1c0wc3, d1c0wd2, d1c0wd3

Details for d1c0wa1

PDB Entry: 1c0w, 3.2 Å

PDB Description: crystal structure of the cobalt-activated diphtheria toxin repressor-dna complex reveals a metal binding sh-like domain

SCOP Domain Sequences for d1c0wa1:

Sequence; same for both SEQRES and ATOM records:

>d1c0wa1 a.4.5.24 (A:2-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
kdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrs
lqm

Timeline for d1c0wa1:

• d1c0wa1 first appeared (with stable ids) in SCOP 1.55
  
• d1c0wa1 appears in SCOP 1.69
  
• d1c0wa1 appears in SCOP 1.73
  
• d1c0wa1 appears in the current release, SCOPe 2.08