Lineage for d1xqwa_ (1xqw A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900251Family c.69.1.7: Proline iminopeptidase-like [53509] (4 proteins)
  6. 2900260Protein Tricorn interacting factor F1 [82502] (1 species)
  7. 2900261Species Thermoplasma acidophilum [TaxId:2303] [82503] (13 PDB entries)
  8. 2900265Domain d1xqwa_: 1xqw A: [162094]
    automated match to d1mt3a_
    complexed with leu, phe; mutant

Details for d1xqwa_

PDB Entry: 1xqw (more details), 2 Å

PDB Description: crystal structure of f1-mutant s105a complex with phe-leu
PDB Compounds: (A:) proline iminopeptidase

SCOPe Domain Sequences for d1xqwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xqwa_ c.69.1.7 (A:) Tricorn interacting factor F1 {Thermoplasma acidophilum [TaxId: 2303]}
ecienyakvngiyiyyklckapeekaklmtmhggpgmshdyllslrdmtkegitvlfydq
fgcgrseepdqskftidygveeaealrsklfgnekvflmgsayggalalayavkyqdhlk
glivsgglssvpltvkemnrlidelpakyrdaikkygssgsyenpeyqeavnyfyhqhll
rsedwppevlksleyaerrnvyrimngpneftitgtikdwditdkisaikiptlitvgey
devtpnvarvihekiagselhvfrdcshltmwedregynkllsdfilkhl

SCOPe Domain Coordinates for d1xqwa_:

Click to download the PDB-style file with coordinates for d1xqwa_.
(The format of our PDB-style files is described here.)

Timeline for d1xqwa_: