![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.7: Proline iminopeptidase-like [53509] (4 proteins) |
![]() | Protein Tricorn interacting factor F1 [82502] (1 species) |
![]() | Species Thermoplasma acidophilum [TaxId:2303] [82503] (13 PDB entries) |
![]() | Domain d1xqwa_: 1xqw A: [162094] automated match to d1mt3a_ complexed with leu, phe; mutant |
PDB Entry: 1xqw (more details), 2 Å
SCOPe Domain Sequences for d1xqwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xqwa_ c.69.1.7 (A:) Tricorn interacting factor F1 {Thermoplasma acidophilum [TaxId: 2303]} ecienyakvngiyiyyklckapeekaklmtmhggpgmshdyllslrdmtkegitvlfydq fgcgrseepdqskftidygveeaealrsklfgnekvflmgsayggalalayavkyqdhlk glivsgglssvpltvkemnrlidelpakyrdaikkygssgsyenpeyqeavnyfyhqhll rsedwppevlksleyaerrnvyrimngpneftitgtikdwditdkisaikiptlitvgey devtpnvarvihekiagselhvfrdcshltmwedregynkllsdfilkhl
Timeline for d1xqwa_: