PDB entry 1xqw

View 1xqw on RCSB PDB site
Description: Crystal structure of F1-mutant S105A complex with PHE-LEU
Class: hydrolase
Keywords: alpha-beta hydrolase, caged active site, catalytic triad, nucleophile
Deposited on 2004-10-13, released 2005-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.248
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proline iminopeptidase
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: TA0830
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96084 (Start-292)
      • engineered (104)
    Domains in SCOPe 2.07: d1xqwa_
  • Heterogens: PHE, LEU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xqwA (A:)
    mdqecienyakvngiyiyyklckapeekaklmtmhggpgmshdyllslrdmtkegitvlf
    ydqfgcgrseepdqskftidygveeaealrsklfgnekvflmgsayggalalayavkyqd
    hlkglivsgglssvpltvkemnrlidelpakyrdaikkygssgsyenpeyqeavnyfyhq
    hllrsedwppevlksleyaerrnvyrimngpneftitgtikdwditdkisaikiptlitv
    geydevtpnvarvihekiagselhvfrdcshltmwedregynkllsdfilkhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xqwA (A:)
    ecienyakvngiyiyyklckapeekaklmtmhggpgmshdyllslrdmtkegitvlfydq
    fgcgrseepdqskftidygveeaealrsklfgnekvflmgsayggalalayavkyqdhlk
    glivsgglssvpltvkemnrlidelpakyrdaikkygssgsyenpeyqeavnyfyhqhll
    rsedwppevlksleyaerrnvyrimngpneftitgtikdwditdkisaikiptlitvgey
    devtpnvarvihekiagselhvfrdcshltmwedregynkllsdfilkhl