SCOP 1.71: Domain d1ddnc1: 1ddn C:3-64

Lineage for d1ddnc1 (1ddn C:3-64)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (61 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.24: Iron-dependent repressor protein [46882] (3 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [46883] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [46884] (16 PDB entries)

8. Domain d1ddnc1: 1ddn C:3-64 [16209]
   Other proteins in same PDB: d1ddna2, d1ddnb2, d1ddnc2, d1ddnd2

Details for d1ddnc1

PDB Entry: 1ddn, 3 Å

PDB Description: diphtheria tox repressor (c102d mutant)/tox dna operator complex

SCOP Domain Sequences for d1ddnc1:

Sequence; same for both SEQRES and ATOM records:

>d1ddnc1 a.4.5.24 (C:3-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
dlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrsl
qm

Timeline for d1ddnc1:

• d1ddnc1 first appeared (with stable ids) in SCOP 1.55
  
• d1ddnc1 appears in SCOP 1.69
  
• d1ddnc1 appears in SCOP 1.73
  
• d1ddnc1 appears in the current release, SCOPe 2.08