SCOP 1.57: Domain d1f5td1: 1f5t D:4002-4064

Lineage for d1f5td1 (1f5t D:4002-4064)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (31 families)

5. Family a.4.5.24: Iron-dependent represor protein [46882] (2 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [46883] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [46884] (11 PDB entries)

8. Domain d1f5td1: 1f5t D:4002-4064 [16206]
   Other proteins in same PDB: d1f5ta2, d1f5tb2, d1f5tc2, d1f5td2

Details for d1f5td1

PDB Entry: 1f5t, 3 Å

PDB Description: diphtheria tox repressor (c102d mutant) complexed with nickel and dtxr consensus binding sequence

SCOP Domain Sequences for d1f5td1:

Sequence; same for both SEQRES and ATOM records:

>d1f5td1 a.4.5.24 (D:4002-4064) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
kdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrs
lqm

Timeline for d1f5td1:

• d1f5td1 first appeared (with stable ids) in SCOP 1.55
  
• d1f5td1 appears in SCOP 1.59
  
• d1f5td1 appears in the current release, SCOPe 2.08