SCOP 1.57: Domain d1f5tc2: 1f5t C:3065-3121

Lineage for d1f5tc2 (1f5t C:3065-3121)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.76: Iron-dependent represor protein, dimerization domain [47978] (1 superfamily)

4. Superfamily a.76.1: Iron-dependent represor protein, dimerization domain [47979] (1 family)

5. Family a.76.1.1: Iron-dependent represor protein, dimerization domain [47980] (2 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [47982] (11 PDB entries)

8. Domain d1f5tc2: 1f5t C:3065-3121 [18411]
   Other proteins in same PDB: d1f5ta1, d1f5tb1, d1f5tc1, d1f5td1

Details for d1f5tc2

PDB Entry: 1f5t, 3 Å

PDB Description: diphtheria tox repressor (c102d mutant) complexed with nickel and dtxr consensus binding sequence

SCOP Domain Sequences for d1f5tc2:

Sequence; same for both SEQRES and ATOM records:

>d1f5tc2 a.76.1.1 (C:3065-3121) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvlk

Timeline for d1f5tc2:

• d1f5tc2 first appeared (with stable ids) in SCOP 1.55
  
• d1f5tc2 appears in SCOP 1.59
  
• d1f5tc2 appears in the current release, SCOPe 2.08