SCOPe 2.03: Domain d1xd9a_: 1xd9 A:

Lineage for d1xd9a_ (1xd9 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein Nitrogenase iron protein [52661] (2 species)

7. Species Azotobacter vinelandii [TaxId:354] [52662] (19 PDB entries)

8. Domain d1xd9a_: 1xd9 A: [162058]
   automated match to d1de0a_
   complexed with adp, mg, sf4

Details for d1xd9a_

PDB Entry: 1xd9, 2.8 Å

PDB Description: crystal structure of the nitrogenase fe protein asp39asn with mgadp bound

PDB Compounds: (A:) nitrogenase iron protein 1

SCOPe Domain Sequences for d1xd9a_:

Sequence; same for both SEQRES and ATOM records:

>d1xd9a_ c.37.1.10 (A:) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcnpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev

Timeline for d1xd9a_:

• d1xd9a_ first appeared in SCOPe 2.01
  
• d1xd9a_ appears in SCOPe 2.02
  
• d1xd9a_ appears in SCOPe 2.04
  
• d1xd9a_ appears in the current release, SCOPe 2.08