| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
| Protein Nitrogenase iron protein [52661] (3 species) |
| Species Azotobacter vinelandii [TaxId:354] [52662] (26 PDB entries) |
| Domain d1xd9a_: 1xd9 A: [162058] automated match to d1de0a_ complexed with adp, mg, sf4 |
PDB Entry: 1xd9 (more details), 2.8 Å
SCOPe Domain Sequences for d1xd9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xd9a_ c.37.1.10 (A:) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcnpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
Timeline for d1xd9a_: