Lineage for d1xd9a_ (1xd9 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. Protein Nitrogenase iron protein [52661] (3 species)
  7. Species Azotobacter vinelandii [TaxId:354] [52662] (25 PDB entries)
  8. Domain d1xd9a_: 1xd9 A: [162058]
    automated match to d1de0a_
    complexed with adp, mg, sf4

Details for d1xd9a_

PDB Entry: 1xd9 (more details), 2.8 Å

PDB Description: crystal structure of the nitrogenase fe protein asp39asn with mgadp bound
PDB Compounds: (A:) nitrogenase iron protein 1

SCOPe Domain Sequences for d1xd9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xd9a_ c.37.1.10 (A:) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcnpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev

SCOPe Domain Coordinates for d1xd9a_ are not available.

Timeline for d1xd9a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xd9b_