Lineage for d1wkob_ (1wko B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383722Fold b.17: PEBP-like [49776] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2383723Superfamily b.17.1: PEBP-like [49777] (3 families) (S)
  5. 2383724Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (4 proteins)
  6. 2383748Protein automated matches [190720] (3 species)
    not a true protein
  7. 2383756Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188074] (1 PDB entry)
  8. 2383758Domain d1wkob_: 1wko B: [161956]
    automated match to d1qoub_

Details for d1wkob_

PDB Entry: 1wko (more details), 1.8 Å

PDB Description: Terminal flower 1 (tfl1) from arabidopsis thaliana
PDB Compounds: (B:) TERMINAL FLOWER 1 protein

SCOPe Domain Sequences for d1wkob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wkob_ b.17.1.1 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rvieplimgrvvgdvldfftpttkmnvsynkkqvsnghelfpssvsskprveihggdlrs
fftlvmidpdvpgpsdpflkehlhwivtnipgttdatfgkevvsyelprpsigihrfvfv
lfrqkqrrvifpnipsrdhfntrkfaveydlglpvaavffnaqre

SCOPe Domain Coordinates for d1wkob_:

Click to download the PDB-style file with coordinates for d1wkob_.
(The format of our PDB-style files is described here.)

Timeline for d1wkob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wkoa_