| Class b: All beta proteins [48724] (178 folds) |
| Fold b.17: PEBP-like [49776] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.17.1: PEBP-like [49777] (3 families) ![]() |
| Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (4 proteins) |
| Protein automated matches [190720] (3 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188074] (1 PDB entry) |
| Domain d1wkob_: 1wko B: [161956] automated match to d1qoub_ |
PDB Entry: 1wko (more details), 1.8 Å
SCOPe Domain Sequences for d1wkob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wkob_ b.17.1.1 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rvieplimgrvvgdvldfftpttkmnvsynkkqvsnghelfpssvsskprveihggdlrs
fftlvmidpdvpgpsdpflkehlhwivtnipgttdatfgkevvsyelprpsigihrfvfv
lfrqkqrrvifpnipsrdhfntrkfaveydlglpvaavffnaqre
Timeline for d1wkob_: