SCOPe 2.08: Domain d1wcxa1: 1wcx A:10-259

Lineage for d1wcxa1 (1wcx A:10-259)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.113: HemD-like [69617] (1 superfamily)
   duplication: consists of two similar 'swapped' domain with 3 layers (a/b/a) each; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.113.1: HemD-like [69618] (1 family)
   automatically mapped to Pfam PF02602

5. Family c.113.1.1: HemD-like [69619] (3 proteins)
   Pfam PF02602

6. Protein automated matches [190804] (2 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [188071] (2 PDB entries)

8. Domain d1wcxa1: 1wcx A:10-259 [161950]
   Other proteins in same PDB: d1wcxa2
   automated match to d1wd7b_
   complexed with gol; mutant

Details for d1wcxa1

PDB Entry: 1wcx, 2 Å

PDB Description: crystal structure of mutant uroporphyrinogen iii synthase from an extremely thermophilic bacterium thermus thermophilus hb8 (l75m/i193m/l248m, semet derivative, form-1 crystal)

PDB Compounds: (A:) Uroporphyrinogen III Synthase

SCOPe Domain Sequences for d1wcxa1:

Sequence; same for both SEQRES and ATOM records:

>d1wcxa1 c.113.1.1 (A:10-259) automated matches {Thermus thermophilus [TaxId: 274]}
rvayaglrrkeafkalaeklgftpllfpvqatekvpvpeyrdqvralaqgvdlflattgv
gvrdlmeagkalgldlegplakafrlargakaaralkeaglpphavgdgtsksllpllpq
grgvaalqlygkplpllenalaergyrvlplmpyrhlpdpegilrleeallrgevdalaf
vaamqveflfegakdpkalrealntrvkalavgrvtadalrewgvkpfyvdeterlgsml
qgfkralqke

Timeline for d1wcxa1:

• d1wcxa1 first appeared in SCOPe 2.01, called d1wcxa_
  
• d1wcxa1 appears in SCOPe 2.07