PDB entry 1wcx

View 1wcx on RCSB PDB site
Description: Crystal Structure of Mutant Uroporphyrinogen III Synthase from an Extremely Thermophilic Bacterium Thermus thermophilus HB8 (L75M/I193M/L248M, SeMet derivative, Form-1 crystal)
Class: lyase
Keywords: Uroporphyrinogen, Porphyrin, Congenital erythropoietic porphyria, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LYASE
Deposited on 2004-05-06, released 2005-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uroporphyrinogen III Synthase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SKH2 (9-End)
      • cloning artifact (7-8)
      • engineered (74)
      • modified residue (160)
      • engineered (192)
      • engineered (247)
    Domains in SCOPe 2.07: d1wcxa1, d1wcxa2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wcxA (A:)
    mrrleedavrvayaglrrkeafkalaeklgftpllfpvqatekvpvpeyrdqvralaqgv
    dlflattgvgvrdlmeagkalgldlegplakafrlargakaaralkeaglpphavgdgts
    ksllpllpqgrgvaalqlygkplpllenalaergyrvlplmpyrhlpdpegilrleeall
    rgevdalafvaamqveflfegakdpkalrealntrvkalavgrvtadalrewgvkpfyvd
    eterlgsmlqgfkralqkeva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wcxA (A:)
    avrvayaglrrkeafkalaeklgftpllfpvqatekvpvpeyrdqvralaqgvdlflatt
    gvgvrdlmeagkalgldlegplakafrlargakaaralkeaglpphavgdgtsksllpll
    pqgrgvaalqlygkplpllenalaergyrvlplmpyrhlpdpegilrleeallrgevdal
    afvaamqveflfegakdpkalrealntrvkalavgrvtadalrewgvkpfyvdeterlgs
    mlqgfkralqke