SCOPe 2.01: Domain d1waaa_: 1waa A:

Lineage for d1waaa_ (1waa A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein automated matches [190803] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188070] (3 PDB entries)

8. Domain d1waaa_: 1waa A: [161930]
   automated match to d1tita_
   complexed with zn

Details for d1waaa_

PDB Entry: 1waa, 1.8 Å

PDB Description: ig27 protein domain

PDB Compounds: (A:) titin

SCOPe Domain Sequences for d1waaa_:

Sequence; same for both SEQRES and ATOM records:

>d1waaa_ b.1.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
amalievekplygvevfvgetahfeielsepdvhgqwklkgqplaaspdceiiedgkkhi
lilhncqlgmtgevsfqaantksaanlkvkel

Timeline for d1waaa_:

• d1waaa_ is new in SCOPe 2.01-stable
  
• d1waaa_ appears in SCOPe 2.02
  
• d1waaa_ appears in the current release, SCOPe 2.08