SCOPe 2.08: Domain d1w6xa1: 1w6x A:174-228

Lineage for d1w6xa1 (1w6x A:174-228)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries)

8. Domain d1w6xa1: 1w6x A:174-228 [161905]
   Other proteins in same PDB: d1w6xa2, d1w6xb2
   automated match to d1k4us_

Details for d1w6xa1

PDB Entry: 1w6x, 2 Å

PDB Description: sh3 domain of p40phox, component of the nadph oxidase

PDB Compounds: (A:) neutrophil cytosol factor 4

SCOPe Domain Sequences for d1w6xa1:

Sequence; same for both SEQRES and ATOM records:

>d1w6xa1 b.34.2.0 (A:174-228) automated matches {Human (Homo sapiens) [TaxId: 9606]}
raealfdftgnsklelnfkagdvifllsrinkdwlegtvrgatgifplsfvkilk

Timeline for d1w6xa1:

• d1w6xa1 first appeared in SCOPe 2.01, called d1w6xa_
  
• d1w6xa1 was called d1w6xa_ in SCOPe 2.07