Lineage for d1w6xb1 (1w6x B:174-228)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. Protein automated matches [190457] (10 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187598] (104 PDB entries)
  8. Domain d1w6xb1: 1w6x B:174-228 [161906]
    Other proteins in same PDB: d1w6xa2, d1w6xb2
    automated match to d1k4us_

Details for d1w6xb1

PDB Entry: 1w6x (more details), 2 Å

PDB Description: sh3 domain of p40phox, component of the nadph oxidase
PDB Compounds: (B:) neutrophil cytosol factor 4

SCOPe Domain Sequences for d1w6xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w6xb1 b.34.2.0 (B:174-228) automated matches {Human (Homo sapiens) [TaxId: 9606]}
raealfdftgnsklelnfkagdvifllsrinkdwlegtvrgatgifplsfvkilk

SCOPe Domain Coordinates for d1w6xb1 are not available.

Timeline for d1w6xb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w6xb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1w6xa1, d1w6xa2