SCOPe 2.04: Domain d1vsta_: 1vst A:

Lineage for d1vsta_ (1vst A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Uracil PRTase, Upp [53293] (5 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [142555] (5 PDB entries)
   Uniprot Q980Q4 2-216

8. Domain d1vsta_: 1vst A: [161870]
   automated match to d1xtta1
   complexed with gtp, mg, prp

Details for d1vsta_

PDB Entry: 1vst, 2.8 Å

PDB Description: symmetric sulfolobus solfataricus uracil phosphoribosyltransferase with bound prpp and gtp

PDB Compounds: (A:) uracil phosphoribosyltransferase

SCOPe Domain Sequences for d1vsta_:

Sequence; same for both SEQRES and ATOM records:

>d1vsta_ c.61.1.1 (A:) Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId: 2287]}
plyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgvk
tkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvyi
yykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkils
kypfiylftvaidpelnnkgyilpglgdagdrafg

Timeline for d1vsta_:

• d1vsta_ first appeared in SCOPe 2.01
  
• d1vsta_ appears in SCOPe 2.03
  
• d1vsta_ appears in SCOPe 2.05
  
• d1vsta_ appears in the current release, SCOPe 2.08