Lineage for d1v7qa_ (1v7q A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 998539Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 998540Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (3 families) (S)
  5. 998541Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)
  6. 998593Protein automated matches [190196] (7 species)
    not a true protein
  7. 998644Species Thermus thermophilus [TaxId:274] [187977] (7 PDB entries)
  8. 998645Domain d1v7qa_: 1v7q A: [161836]
    automated match to d1v37a_

Details for d1v7qa_

PDB Entry: 1v7q (more details), 1.59 Å

PDB Description: Crystal structure of phosphoglycerate mutase from Thermus thermophilus HB8
PDB Compounds: (A:) phosphoglycerate mutase

SCOPe Domain Sequences for d1v7qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7qa_ c.60.1.1 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdllrarrtae
lagfsprlypelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrf
leglkapavlfthggvvravlralgedglvppgsavavdwprrvlvrla

SCOPe Domain Coordinates for d1v7qa_:

Click to download the PDB-style file with coordinates for d1v7qa_.
(The format of our PDB-style files is described here.)

Timeline for d1v7qa_: