Lineage for d1u0ad_ (1u0a D:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2050469Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 proteins)
    Pfam PF00722
    beta-Glucanase-like
  6. 2050470Protein Bacillus 1-3,1-4-beta-glucanase [49926] (5 species)
  7. 2050491Species Paenibacillus macerans [TaxId:44252] [188026] (1 PDB entry)
  8. 2050495Domain d1u0ad_: 1u0a D: [161795]
    automated match to d1byha_
    complexed with ca, zn

Details for d1u0ad_

PDB Entry: 1u0a (more details), 1.64 Å

PDB Description: crystal structure of the engineered beta-1,3-1,4-endoglucanase h(a16- m) in complex with beta-glucan tetrasaccharide
PDB Compounds: (D:) Beta-glucanase

SCOPe Domain Sequences for d1u0ad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0ad_ b.29.1.2 (D:) Bacillus 1-3,1-4-beta-glucanase {Paenibacillus macerans [TaxId: 44252]}
qtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklklgltssaynkfd
caeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdqidiqflgkdttkvqf
nyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgkim
mnlwngtgvddwlgsynganplyaeydwvkytsn

SCOPe Domain Coordinates for d1u0ad_:

Click to download the PDB-style file with coordinates for d1u0ad_.
(The format of our PDB-style files is described here.)

Timeline for d1u0ad_: