SCOPe 2.07: Domain d1ttoa_: 1tto A:

Lineage for d1ttoa_ (1tto A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.4: Fungal ribonucleases [81311] (4 proteins)

6. Protein RNase T1 [53939] (2 species)

7. Species Fungus (Aspergillus oryzae) [TaxId:5062] [53940] (67 PDB entries)

8. Domain d1ttoa_: 1tto A: [161783]
   automated match to d1q9ea_
   complexed with trs

Details for d1ttoa_

PDB Entry: 1tto, 2.1 Å

PDB Description: crystal structure of the rnase t1 variant r2

PDB Compounds: (A:) RNase T1

SCOPe Domain Sequences for d1ttoa_:

Sequence; same for both SEQRES and ATOM records:

>d1ttoa_ d.1.1.4 (A:) RNase T1 {Fungus (Aspergillus oryzae) [TaxId: 5062]}
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphefrnwngfdfsvsspyyeyp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect

Timeline for d1ttoa_:

• d1ttoa_ first appeared in SCOPe 2.01
  
• d1ttoa_ appears in SCOPe 2.06
  
• d1ttoa_ appears in the current release, SCOPe 2.08