Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins) |
Protein Viral RNA polymerase [56695] (17 species) |
Species Human rhinovirus 16 [TaxId:31708] [188024] (2 PDB entries) |
Domain d1tp7b_: 1tp7 B: [161780] automated match to d1xr6a_ complexed with dmx, so4 |
PDB Entry: 1tp7 (more details), 2.4 Å
SCOPe Domain Sequences for d1tp7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tp7b_ e.8.1.4 (B:) Viral RNA polymerase {Human rhinovirus 16 [TaxId: 31708]} gqiqiskhvkdvglpsihtptktklqpsvfydifpgskepavltekdprlkvdfdsalfs kykgntecslnehiqvavahysaqlatldidpqpiamedsvfgmdglealdlntsagypy vtlgikkkdlinnktkdisklklaldkydvdlpmitflkdelrkkdkiaagktrvieass indtilfrtvygnlfskfhlnpgvvtgcavgcdpetfwskiplmldgdcimafdytnydg sihpiwfkalgmvldnlsfnptlinrlcnskhifkstyyeveggvpsgcsgtsifnsmin niiirtlvldaykhidldklkiiaygddvifsykykldmeaiakegqkygltitpadkss efkeldygnvtflkrgfrqddkykflihptfpveeiyesirwtkkpsqmqehvlslchlm whngpeiykdfetkirsvsagralyippyellrhewyekf
Timeline for d1tp7b_: