Lineage for d1tp7b_ (1tp7 B:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1951566Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1951567Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1952391Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 1952399Protein Viral RNA polymerase [56695] (17 species)
  7. 1952631Species Human rhinovirus 16 [TaxId:31708] [188024] (2 PDB entries)
  8. 1952633Domain d1tp7b_: 1tp7 B: [161780]
    automated match to d1xr6a_
    complexed with dmx, so4

Details for d1tp7b_

PDB Entry: 1tp7 (more details), 2.4 Å

PDB Description: Crystal Structure of the RNA-dependent RNA Polymerase from Human Rhinovirus 16
PDB Compounds: (B:) Genome polyprotein

SCOPe Domain Sequences for d1tp7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tp7b_ e.8.1.4 (B:) Viral RNA polymerase {Human rhinovirus 16 [TaxId: 31708]}
gqiqiskhvkdvglpsihtptktklqpsvfydifpgskepavltekdprlkvdfdsalfs
kykgntecslnehiqvavahysaqlatldidpqpiamedsvfgmdglealdlntsagypy
vtlgikkkdlinnktkdisklklaldkydvdlpmitflkdelrkkdkiaagktrvieass
indtilfrtvygnlfskfhlnpgvvtgcavgcdpetfwskiplmldgdcimafdytnydg
sihpiwfkalgmvldnlsfnptlinrlcnskhifkstyyeveggvpsgcsgtsifnsmin
niiirtlvldaykhidldklkiiaygddvifsykykldmeaiakegqkygltitpadkss
efkeldygnvtflkrgfrqddkykflihptfpveeiyesirwtkkpsqmqehvlslchlm
whngpeiykdfetkirsvsagralyippyellrhewyekf

SCOPe Domain Coordinates for d1tp7b_:

Click to download the PDB-style file with coordinates for d1tp7b_.
(The format of our PDB-style files is described here.)

Timeline for d1tp7b_: