Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins) |
Protein 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) [51602] (4 species) |
Species Aquifex aeolicus [TaxId:63363] [63922] (32 PDB entries) |
Domain d1t8xb_: 1t8x B: [161751] automated match to d1pe1a_ complexed with a5p, cd, pep, po4 |
PDB Entry: 1t8x (more details), 1.8 Å
SCOPe Domain Sequences for d1t8xb_:
Sequence, based on SEQRES records: (download)
>d1t8xb_ c.1.10.4 (B:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Aquifex aeolicus [TaxId: 63363]} kflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgley gvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcgqtdlllaaaktgravn vkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviyd athsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdastqlplsq legiieaileirevaskyyeti
>d1t8xb_ c.1.10.4 (B:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Aquifex aeolicus [TaxId: 63363]} kflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgley gvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcgqtdlllaaaktgravn vkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviyd athsvqlpgggmrefifpliraavavgcdgvfmethpepekalsdastqlplsqlegiie aileirevaskyyeti
Timeline for d1t8xb_: