Lineage for d1shme_ (1shm E:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289963Protein automated matches [190119] (16 species)
    not a true protein
  7. 1290216Species Llama (Lama glama) [TaxId:9844] [187485] (60 PDB entries)
  8. 1290254Domain d1shme_: 1shm E: [161719]
    automated match to d1g9ea_

Details for d1shme_

PDB Entry: 1shm (more details), 1.9 Å

PDB Description: Convergent solutions to VHH domain stabilization from natural and in vitro evolution
PDB Compounds: (E:) antibody rig

SCOPe Domain Sequences for d1shme_:

Sequence, based on SEQRES records: (download)

>d1shme_ b.1.1.1 (E:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqaggslrlscaasgatgstydmgwfrqapgkeresvaainwgsagtyya
ssvrgrftisrdnakktvylqmnslkpedtavytcgagrigrsvfnlrreswvtwwgqgt
qvtvss

Sequence, based on observed residues (ATOM records): (download)

>d1shme_ b.1.1.1 (E:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqaggslrlscaasgatgstydmgwfrqapgkeresvaainwgsagtyya
ssvrgrftisrdnakktvylqmnslkpedtavytcgagrireswvtwwgqgtqvtvss

SCOPe Domain Coordinates for d1shme_:

Click to download the PDB-style file with coordinates for d1shme_.
(The format of our PDB-style files is described here.)

Timeline for d1shme_: