![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (15 species) not a true protein |
![]() | Species Llama (Lama glama) [TaxId:9844] [187485] (23 PDB entries) |
![]() | Domain d1shme_: 1shm E: [161719] automated match to d1g9ea_ |
PDB Entry: 1shm (more details), 1.9 Å
SCOPe Domain Sequences for d1shme_:
Sequence, based on SEQRES records: (download)
>d1shme_ b.1.1.1 (E:) automated matches {Llama (Lama glama) [TaxId: 9844]} vqlqesggglvqaggslrlscaasgatgstydmgwfrqapgkeresvaainwgsagtyya ssvrgrftisrdnakktvylqmnslkpedtavytcgagrigrsvfnlrreswvtwwgqgt qvtvss
>d1shme_ b.1.1.1 (E:) automated matches {Llama (Lama glama) [TaxId: 9844]} vqlqesggglvqaggslrlscaasgatgstydmgwfrqapgkeresvaainwgsagtyya ssvrgrftisrdnakktvylqmnslkpedtavytcgagrireswvtwwgqgtqvtvss
Timeline for d1shme_: