Lineage for d1shma_ (1shm A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2743713Domain d1shma_: 1shm A: [161716]
    automated match to d1g9ea_

Details for d1shma_

PDB Entry: 1shm (more details), 1.9 Å

PDB Description: Convergent solutions to VHH domain stabilization from natural and in vitro evolution
PDB Compounds: (A:) antibody rig

SCOPe Domain Sequences for d1shma_:

Sequence, based on SEQRES records: (download)

>d1shma_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqaggslrlscaasgatgstydmgwfrqapgkeresvaainwgsagtyya
ssvrgrftisrdnakktvylqmnslkpedtavytcgagrigrsvfnlrreswvtwwgqgt
qvtvss

Sequence, based on observed residues (ATOM records): (download)

>d1shma_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqaggslrlscaasgatgstydmgwfrqapgkeresvaainwgsagtyya
ssvrgrftisrdnakktvylqmnslkpedtavytcgagrireswvtwwgqgtqvtvss

SCOPe Domain Coordinates for d1shma_:

Click to download the PDB-style file with coordinates for d1shma_.
(The format of our PDB-style files is described here.)

Timeline for d1shma_: