SCOPe 2.04: Domain d1rl8a_: 1rl8 A:

Lineage for d1rl8a_ (1rl8 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (8 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (432 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d1rl8a_: 1rl8 A: [161684]
   automated match to d1odya_
   complexed with rit; mutant

Details for d1rl8a_

PDB Entry: 1rl8, 2 Å

PDB Description: crystal structure of the complex of resistant strain of hiv-1 protease(v82a mutant) with ritonavir

PDB Compounds: (A:) protease retropepsin

SCOPe Domain Sequences for d1rl8a_:

Sequence; same for both SEQRES and ATOM records:

>d1rl8a_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgawkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpaniigrnlltqigctlnf

Timeline for d1rl8a_:

• d1rl8a_ first appeared in SCOPe 2.01
  
• d1rl8a_ appears in SCOPe 2.03
  
• d1rl8a_ appears in SCOPe 2.05
  
• d1rl8a_ appears in the current release, SCOPe 2.08