| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
| Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
| Protein automated matches [190231] (8 species) not a true protein |
| Species Mastigocladus laminosus [TaxId:83541] [188017] (2 PDB entries) |
| Domain d1rfkb_: 1rfk B: [161683] automated match to d1j7aa_ complexed with fes |
PDB Entry: 1rfk (more details), 1.25 Å
SCOPe Domain Sequences for d1rfkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rfkb_ d.15.4.1 (B:) automated matches {Mastigocladus laminosus [TaxId: 83541]}
atykvtlineaeglnktievpddqyildaaeeagidlpyscragacstcagklisgtvdq
sdqsfldddqieagyvltcvayptsdcviethkeeel
Timeline for d1rfkb_: