Lineage for d1bc8c_ (1bc8 C:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45282Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 45500Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (31 families) (S)
  5. 45670Family a.4.5.21: ets domain [46859] (6 proteins)
  6. 45688Protein Serum responce factor accessory protein 1a, SAP-1 [46869] (1 species)
  7. 45689Species Human (Homo sapiens) [TaxId:9606] [46870] (3 PDB entries)
  8. 45690Domain d1bc8c_: 1bc8 C: [16168]

Details for d1bc8c_

PDB Entry: 1bc8 (more details), 1.93 Å

PDB Description: structures of sap-1 bound to dna sequences from the e74 and c-fos promoters provide insights into how ets proteins discriminate between related dna targets

SCOP Domain Sequences for d1bc8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bc8c_ a.4.5.21 (C:) Serum responce factor accessory protein 1a, SAP-1 {Human (Homo sapiens)}
mdsaitlwqfllqllqkpqnkhmicwtsndgqfkllqaeevarlwgirknkpnmnydkls
ralryyyvkniikkvngqkfvykfvsypeilnm

SCOP Domain Coordinates for d1bc8c_:

Click to download the PDB-style file with coordinates for d1bc8c_.
(The format of our PDB-style files is described here.)

Timeline for d1bc8c_: