Lineage for d3ejdf_ (3ejd F:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1277465Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1277466Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1278000Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1278001Protein automated matches [190847] (33 species)
    not a true protein
  7. 1278008Species Bacillus subtilis [TaxId:1423] [188626] (3 PDB entries)
  8. 1278015Domain d3ejdf_: 3ejd F: [161668]
    Other proteins in same PDB: d3ejda_, d3ejdc_, d3ejde_, d3ejdg_
    automated match to d1jipa_
    complexed with cl, hem, htg, zmq

Details for d3ejdf_

PDB Entry: 3ejd (more details), 2.1 Å

PDB Description: crystal structure of p450bioi in complex with hexadec-9z-enoic acid ligated acyl carrier protein
PDB Compounds: (F:) Biotin biosynthesis cytochrome P450-like enzyme

SCOPe Domain Sequences for d3ejdf_:

Sequence, based on SEQRES records: (download)

>d3ejdf_ a.104.1.0 (F:) automated matches {Bacillus subtilis [TaxId: 1423]}
seflknpysfydtlravhpiykgsflkypgwyvtgyeetaailkdarfkvrtplpesstk
yqdlshvqnqmmlfqnqpdhrrlrtlasgaftprttesyqpyiietvhhlldqvqgkkkm
evisdfafplasfvianiigvpeedreqlkewaasliqtidftrsrkaltegnimavqam
ayfkeliqkrkrhpqqdmismllkgrekdklteeeaastcillaiaghettvnlisnsvl
cllqhpeqllklrenpdligtaveeclryesptqmtarvasedidicgvtirqgeqvyll
lgaanrdpsiftnpdvfditrspnphlsfghghhvclgsslarleaqiaintllqrmpsl
nladfewryrplfgfraleelpvtfe

Sequence, based on observed residues (ATOM records): (download)

>d3ejdf_ a.104.1.0 (F:) automated matches {Bacillus subtilis [TaxId: 1423]}
seflknpysfydtlravhpiykgsflkypgwyvtgyeetaailkdarfkvrtplpesstk
yqdlshvqnqmmlfqnqpdhrrlrtlasgaftprttesyqpyiietvhhlldqvqgkkkm
evisdfafplasfvianiigvpeedreqlkewaasliqtidftrsrkaltegnimavqam
ayfkeliqkrkrhpqqdmismllkgrdklteeeaastcillaiaghettvnlisnsvlcl
lqhpeqllklrenpdligtaveeclryesptqmtarvasedidicgvtirqgeqvylllg
aanrdpsiftnpdvfditrspnphlsfghghhvclgsslarleaqiaintllqrmpslnl
awryrplfgfraleelpvtfe

SCOPe Domain Coordinates for d3ejdf_:

Click to download the PDB-style file with coordinates for d3ejdf_.
(The format of our PDB-style files is described here.)

Timeline for d3ejdf_: