![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
![]() | Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins) |
![]() | Protein Acyl carrier protein [47338] (6 species) |
![]() | Species Escherichia coli [TaxId:562] [47339] (11 PDB entries) Uniprot P02901 |
![]() | Domain d3ejde_: 3ejd E: [158174] Other proteins in same PDB: d3ejdb_, d3ejdd_, d3ejdf_, d3ejdh_ automated match to d1t8ka_ complexed with cl, hem, htg, zmq |
PDB Entry: 3ejd (more details), 2.1 Å
SCOPe Domain Sequences for d3ejde_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ejde_ a.28.1.1 (E:) Acyl carrier protein {Escherichia coli [TaxId: 562]} shmstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipde eaekittvqaaidyingh
Timeline for d3ejde_: