Lineage for d1puef_ (1pue F:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149792Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 150081Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (35 families) (S)
  5. 150274Family a.4.5.21: ets domain [46859] (6 proteins)
  6. 150305Protein Transcription factor PU.1, residues 171-259 [46865] (1 species)
  7. 150306Species Mouse (Mus musculus) [TaxId:10090] [46866] (1 PDB entry)
  8. 150308Domain d1puef_: 1pue F: [16166]

Details for d1puef_

PDB Entry: 1pue (more details), 2.1 Å

PDB Description: pu.1 ets domain-dna complex

SCOP Domain Sequences for d1puef_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1puef_ a.4.5.21 (F:) Transcription factor PU.1, residues 171-259 {Mouse (Mus musculus)}
kirlyqflldllrsgdmkdsiwwvdkdkgtfqfsskhkealahrwgiqkgnrkkmtyekm
aralrnygktgevkkvkkkltyqfsgevl

SCOP Domain Coordinates for d1puef_:

Click to download the PDB-style file with coordinates for d1puef_.
(The format of our PDB-style files is described here.)

Timeline for d1puef_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1puee_