Lineage for d3dcgc_ (3dcg C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1892546Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1892571Protein Elongin B [54246] (2 species)
  7. 1892572Species Human (Homo sapiens) [TaxId:9606] [54247] (27 PDB entries)
  8. 1892580Domain d3dcgc_: 3dcg C: [161650]
    Other proteins in same PDB: d3dcgb_, d3dcgd_
    automated match to d1lm8b_
    protein/RNA complex

Details for d3dcgc_

PDB Entry: 3dcg (more details), 2.4 Å

PDB Description: Crystal Structure of the HIV Vif BC-box in Complex with Human ElonginB and ElonginC
PDB Compounds: (C:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d3dcgc_:

Sequence, based on SEQRES records: (download)

>d3dcgc_ d.15.1.1 (C:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppe

Sequence, based on observed residues (ATOM records): (download)

>d3dcgc_ d.15.1.1 (C:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafradtfealciepfssppe

SCOPe Domain Coordinates for d3dcgc_:

Click to download the PDB-style file with coordinates for d3dcgc_.
(The format of our PDB-style files is described here.)

Timeline for d3dcgc_: