SCOP 1.65: Domain d1puee_: 1pue E:

Lineage for d1puee_ (1pue E:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (36 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.21: ets domain [46859] (6 proteins)

6. Protein Transcription factor PU.1, residues 171-259 [46865] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [46866] (1 PDB entry)

8. Domain d1puee_: 1pue E: [16165]

Details for d1puee_

PDB Entry: 1pue, 2.1 Å

PDB Description: pu.1 ets domain-dna complex

SCOP Domain Sequences for d1puee_:

Sequence; same for both SEQRES and ATOM records:

>d1puee_ a.4.5.21 (E:) Transcription factor PU.1, residues 171-259 {Mouse (Mus musculus)}
kirlyqflldllrsgdmkdsiwwvdkdkgtfqfsskhkealahrwgiqkgnrkkmtyekm
aralrnygktgevkkvkkkltyqfsgev

Timeline for d1puee_:

• d1puee_ first appeared (with stable ids) in SCOP 1.55
  
• d1puee_ appears in SCOP 1.63
  
• d1puee_ appears in SCOP 1.67
  
• d1puee_ appears in the current release, SCOPe 2.08