Lineage for d2stta_ (2stt A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438531Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families) (S)
    contains a small beta-sheet (wing)
  5. 438776Family a.4.5.21: ets domain [46859] (6 proteins)
  6. 438781Protein ETS-1 transcription factor, residues 331-440 [46862] (2 species)
  7. 438782Species Human (Homo sapiens) [TaxId:9606] [46864] (3 PDB entries)
  8. 438785Domain d2stta_: 2stt A: [16163]

Details for d2stta_

PDB Entry: 2stt (more details)

PDB Description: solution nmr structure of the human ets1/dna complex, 25 structures

SCOP Domain Sequences for d2stta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2stta_ a.4.5.21 (A:) ETS-1 transcription factor, residues 331-440 {Human (Homo sapiens)}
vipaaalagytgsgpiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrk
nkpkmnyeklsrglryyydkniihktagkryvyrfv

SCOP Domain Coordinates for d2stta_:

Click to download the PDB-style file with coordinates for d2stta_.
(The format of our PDB-style files is described here.)

Timeline for d2stta_: