SCOPe 2.07: Domain d3cptb_: 3cpt B:

Lineage for d3cptb_ (3cpt B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families)
   alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices

5. Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
   Pfam PF03259

6. Protein Late endosomal/lysosomal Mp1 interacting protein p14 [111123] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [111124] (5 PDB entries)
   Uniprot Q9JHS3

8. Domain d3cptb_: 3cpt B: [161629]
   Other proteins in same PDB: d3cpta_
   automated match to d1szva1

Details for d3cptb_

PDB Entry: 3cpt, 1.9 Å

PDB Description: mp1-p14 scaffolding complex

PDB Compounds: (B:) Mitogen-activated protein-binding protein-interacting protein

SCOPe Domain Sequences for d3cptb_:

Sequence; same for both SEQRES and ATOM records:

>d3cptb_ d.110.7.1 (B:) Late endosomal/lysosomal Mp1 interacting protein p14 {Mouse (Mus musculus) [TaxId: 10090]}
lrpkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaadrngn
qafnedslkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqylee

Timeline for d3cptb_:

• d3cptb_ first appeared in SCOPe 2.01
  
• d3cptb_ appears in SCOPe 2.06
  
• d3cptb_ appears in the current release, SCOPe 2.08