Lineage for d1flia_ (1fli A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 277521Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 277839Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (36 families) (S)
    contains a small beta-sheet (wing)
  5. 278056Family a.4.5.21: ets domain [46859] (6 proteins)
  6. 278077Protein Fli-1 [46860] (1 species)
  7. 278078Species Human (Homo sapiens) [TaxId:9606] [46861] (1 PDB entry)
  8. 278079Domain d1flia_: 1fli A: [16160]
    protein/DNA complex

Details for d1flia_

PDB Entry: 1fli (more details)

PDB Description: dna-binding domain of fli-1

SCOP Domain Sequences for d1flia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1flia_ a.4.5.21 (A:) Fli-1 {Human (Homo sapiens)}
pgsgqiqlwqfllellsdsanascitwegtngefkmtdpdevarrwgerkskpnmnydkl
sralryyydknimtkvhgkryaykfdfhgiaqalqphp

SCOP Domain Coordinates for d1flia_:

Click to download the PDB-style file with coordinates for d1flia_.
(The format of our PDB-style files is described here.)

Timeline for d1flia_: