SCOPe 2.04: Domain d2vlqb_: 2vlq B:

Lineage for d2vlqb_ (2vlq B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
   core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures

4. Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families)
   common motif contains conserved histidine residue and metal-binding site

5. Family d.4.1.1: HNH-motif [54061] (3 proteins)

6. Protein automated matches [190311] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187878] (9 PDB entries)

8. Domain d2vlqb_: 2vlq B: [161583]
   Other proteins in same PDB: d2vlqa_
   automated match to d1fsjb_
   protein/DNA complex; complexed with mla; mutant

Details for d2vlqb_

PDB Entry: 2vlq, 1.6 Å

PDB Description: f86a mutant of e9 dnase domain in complex with im9

PDB Compounds: (B:) colicin e9

SCOPe Domain Sequences for d2vlqb_:

Sequence; same for both SEQRES and ATOM records:

>d2vlqb_ d.4.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
meskrnkpgkatgkgkpvgdkwlddagkdsgapipdriadklrdkefksfddfrkavwee
vskdpelsknlnpsnkssvskgyspatpknqqvggrkvyelhhdkpisqggevydmdnir
vttpkrhidihrgk

Timeline for d2vlqb_:

• d2vlqb_ first appeared in SCOPe 2.01
  
• d2vlqb_ appears in SCOPe 2.03
  
• d2vlqb_ appears in SCOPe 2.05
  
• d2vlqb_ appears in the current release, SCOPe 2.08