|  | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) | 
|  | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha | 
|  | Superfamily d.110.4: SNARE-like [64356] (4 families)  beta(2)-alpha-beta(3)-alpha(2) | 
|  | Family d.110.4.2: Clathrin coat assembly domain [75521] (2 proteins) automatically mapped to Pfam PF01217 | 
|  | Protein Mu2 adaptin (clathrin coat assembly protein AP50) [75522] (1 species) | 
|  | Species Norway rat (Rattus norvegicus) [TaxId:10116] [75523] (1 PDB entry) | 
|  | Domain d2vglm1: 2vgl M:1-141 [161578] Other proteins in same PDB: d2vgla_, d2vglb_, d2vgls_ complexed with ihp | 
PDB Entry: 2vgl (more details), 2.59 Å
SCOPe Domain Sequences for d2vglm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vglm1 d.110.4.2 (M:1-141) Mu2 adaptin (clathrin coat assembly protein AP50) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
migglfiynhkgevlisrvyrddigrnavdafrvnviharqqvrspvtniartsffhvkr
sniwlaavtkqnvnaamvfeflykmcdvmaayfgkiseeniknnfvliyelldeildfgy
pqnsetgalktfitqqgiksq
Timeline for d2vglm1: