Lineage for d2vglm1 (2vgl M:1-141)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1427772Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1428237Superfamily d.110.4: SNARE-like [64356] (4 families) (S)
    beta(2)-alpha-beta(3)-alpha(2)
  5. 1428250Family d.110.4.2: Clathrin coat assembly domain [75521] (2 proteins)
    automatically mapped to Pfam PF01217
  6. 1428251Protein Mu2 adaptin (clathrin coat assembly protein AP50) [75522] (1 species)
  7. 1428252Species Norway rat (Rattus norvegicus) [TaxId:10116] [75523] (1 PDB entry)
  8. 1428253Domain d2vglm1: 2vgl M:1-141 [161578]
    Other proteins in same PDB: d2vgla_, d2vglb_, d2vgls_
    complexed with ihp

Details for d2vglm1

PDB Entry: 2vgl (more details), 2.59 Å

PDB Description: ap2 clathrin adaptor core
PDB Compounds: (M:) ap-2 complex subunit mu-1

SCOPe Domain Sequences for d2vglm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vglm1 d.110.4.2 (M:1-141) Mu2 adaptin (clathrin coat assembly protein AP50) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
migglfiynhkgevlisrvyrddigrnavdafrvnviharqqvrspvtniartsffhvkr
sniwlaavtkqnvnaamvfeflykmcdvmaayfgkiseeniknnfvliyelldeildfgy
pqnsetgalktfitqqgiksq

SCOPe Domain Coordinates for d2vglm1:

Click to download the PDB-style file with coordinates for d2vglm1.
(The format of our PDB-style files is described here.)

Timeline for d2vglm1: