SCOPe 2.01: Domain d2rg9a_: 2rg9 A:

Lineage for d2rg9a_ (2rg9 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein automated matches [190420] (8 species)
   not a true protein

7. Species European mistletoe (Viscum album) [TaxId:3972] [188629] (3 PDB entries)

8. Domain d2rg9a_: 2rg9 A: [161550]
   Other proteins in same PDB: d2rg9b1, d2rg9b2
   automated match to d1puua_
   complexed with azi, cl, gol, nag, so4

Details for d2rg9a_

PDB Entry: 2rg9, 1.95 Å

PDB Description: crystal structure of viscum album mistletoe lectin i in native state at 1.95 a resolution, comparison of structure active site conformation in ricin and in viscumin

PDB Compounds: (A:) Beta-galactoside-specific lectin 1 chain A isoform 1

SCOPe Domain Sequences for d2rg9a_:

Sequence; same for both SEQRES and ATOM records:

>d2rg9a_ d.165.1.1 (A:) automated matches {European mistletoe (Viscum album) [TaxId: 3972]}
yerlslrtvqqttgeeyfsfitllrdfvssgsfsnnipllrqstipvseasrfvlveltn
eggdsitaaidvtnlyvvayqagqqsyflkdaprgaetqdftgttrsslpfngsypdler
yaghrdqiplgidqliqsvtalrfpggstrtqarsililiqmiseaarfnpilwrarqyi
nsgasflpdvymleletswgqqstqvqhstdgvfnnpirlalppgnvvtltnirdviasl
aimlfvcge

Timeline for d2rg9a_:

• d2rg9a_ is new in SCOPe 2.01-stable
  
• d2rg9a_ appears in SCOPe 2.02
  
• d2rg9a_ appears in the current release, SCOPe 2.08