Lineage for d1qbja_ (1qbj A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983064Family a.4.5.19: Z-DNA binding domain [46853] (5 proteins)
    Pfam PF02295
  6. 1983075Protein Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 [46854] (1 species)
  7. 1983076Species Human (Homo sapiens) [TaxId:9606] [46855] (8 PDB entries)
  8. 1983078Domain d1qbja_: 1qbj A: [16155]
    protein/DNA complex

Details for d1qbja_

PDB Entry: 1qbj (more details), 2.1 Å

PDB Description: crystal structure of the zalpha z-dna complex
PDB Compounds: (A:) protein (double-stranded RNA specific adenosine deaminase (adar1))

SCOPe Domain Sequences for d1qbja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qbja_ a.4.5.19 (A:) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]}
siyqdqeqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpp
lwkia

SCOPe Domain Coordinates for d1qbja_:

Click to download the PDB-style file with coordinates for d1qbja_.
(The format of our PDB-style files is described here.)

Timeline for d1qbja_: