Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily) 12 transmembrane helices in an approximate threefold rotational symmetric arrangement |
Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) |
Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins) the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3 |
Protein Bacterial ba3 type cytochrome c oxidase subunit I [81438] (1 species) |
Species Thermus thermophilus [TaxId:274] [81437] (25 PDB entries) |
Domain d2qpea_: 2qpe A: [161538] Other proteins in same PDB: d2qpeb1, d2qpeb2, d2qpec_ automated match to d1ehka_ complexed with cu1, cua, has, hem |
PDB Entry: 2qpe (more details), 2.9 Å
SCOPe Domain Sequences for d2qpea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qpea_ f.24.1.1 (A:) Bacterial ba3 type cytochrome c oxidase subunit I {Thermus thermophilus [TaxId: 274]} seisrvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsy yqgltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpll aneatvlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtym avvfwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpaya iiytilpkqaggrlvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfv avpslmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggiv nasftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavv wlwflgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfi yglfsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygpt lvqlfghlnpvpgwrlw
Timeline for d2qpea_: