Lineage for d2pt7f_ (2pt7 F:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1165223Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 1165496Protein Hexameric traffic ATPase, HP0525 [52719] (1 species)
    type II/IV secretion system protein; includes N-terminal alpha+beta domain of a profilin-like topology
  7. 1165497Species Helicobacter pylori [TaxId:210] [52720] (5 PDB entries)
  8. 1165505Domain d2pt7f_: 2pt7 F: [161512]
    automated match to d1g6oa_

Details for d2pt7f_

PDB Entry: 2pt7 (more details), 2.4 Å

PDB Description: Crystal structure of Cag VirB11 (HP0525) and an inhibitory protein (HP1451)
PDB Compounds: (F:) Cag-alfa

SCOPe Domain Sequences for d2pt7f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pt7f_ c.37.1.11 (F:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]}
eaalnplrhateelfgdflkmeniteicyngnkvvwvlknngewqpfdvrdrkafslsrl
mhfarccasfkkktidnyenpilssnlangervqivlspvtvndetisisiripskttyp
hsffeeqgfynlldnkeqaisaikdgiaigknvivcggtgsgkttyiksimefipkeeri
isiedteeivfkhhknytqlffggnitsadclksclrmrpdriilgelrsseaydfynvl
csghkgtlttlhagsseeafirlanmsssnsaarnikfesliegfkdlidmivhinhhkq
cdefyik

SCOPe Domain Coordinates for d2pt7f_:

Click to download the PDB-style file with coordinates for d2pt7f_.
(The format of our PDB-style files is described here.)

Timeline for d2pt7f_: