Lineage for d2o57c_ (2o57 C:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1175720Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1175721Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1176138Family c.66.1.18: Mycolic acid cyclopropane synthase [69560] (7 proteins)
  6. 1176165Protein Putative sarcosine dimethylglycine methyltransferase [159680] (1 species)
    sequence similarity to other families with less structural similarity
  7. 1176166Species Red algae (Galdieria sulphuraria) [TaxId:130081] [159681] (1 PDB entry)
  8. 1176169Domain d2o57c_: 2o57 C: [161486]
    automated match to d2o57a1

Details for d2o57c_

PDB Entry: 2o57 (more details), 1.95 Å

PDB Description: crystal structure of a putative sarcosine dimethylglycine methyltransferase from galdieria sulphuraria
PDB Compounds: (C:) putative sarcosine dimethylglycine methyltransferase

SCOPe Domain Sequences for d2o57c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o57c_ c.66.1.18 (C:) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]}
yyddddsdrfyfhvwggedihvglykepvdqdeireaslrtdewlaselamtgvlqrqak
gldlgagyggaarflvrkfgvsidclniapvqnkrneeynnqagladnitvkygsfleip
cednsydfiwsqdaflhspdklkvfqecarvlkprgvmaitdpmkedgidkssiqpildr
iklhdmgslglyrslakecglvtlrtfsrpdslvhhyskvkaelikrsseiasfcspefq
anmkrglehwieggragkltwggmlfrksdki

SCOPe Domain Coordinates for d2o57c_:

Click to download the PDB-style file with coordinates for d2o57c_.
(The format of our PDB-style files is described here.)

Timeline for d2o57c_: