Lineage for d2i3cb_ (2i3c B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1173024Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1173859Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 1174216Family c.56.5.7: AstE/AspA-like [142526] (3 proteins)
    Pfam PF04952; Succinylglutamate desuccinylase / Aspartoacylase family; contains extra C-terminal domain, new variant of the Barrel-sandwich hybrid fold (51229)
  6. 1174217Protein Aspartoacylase AspA [159649] (2 species)
  7. 1174218Species Human (Homo sapiens) [TaxId:9606] [159651] (4 PDB entries)
    Uniprot P45381 9-310
  8. 1174222Domain d2i3cb_: 2i3c B: [161460]
    automated match to d2i3ca1
    complexed with po4, zn

Details for d2i3cb_

PDB Entry: 2i3c (more details), 2.8 Å

PDB Description: crystal structure of an aspartoacylase from homo sapiens
PDB Compounds: (B:) Aspartoacylase

SCOPe Domain Sequences for d2i3cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i3cb_ c.56.5.7 (B:) Aspartoacylase AspA {Human (Homo sapiens) [TaxId: 9606]}
ehiqkvaifggthgneltgvflvkhwlengaeiqrtglevkpfitnpravkkctryidcd
lnrifdlenlgkkmsedlpyevrraqeinhlfgpkdsedsydiifdlhnttsnmgctlil
edsrnnfliqmfhyiktslaplpcyvyliehpslkyattrsiakypvgievgpqpqgvlr
adildqmrkmikhaldfihhfnegkefppcaievykiiekvdyprdengeiaaiihpnlq
dqdwkplhpgdpmfltldgktiplggdctvypvfvneaayyekkeafakttkltlnaksi
rc

SCOPe Domain Coordinates for d2i3cb_:

Click to download the PDB-style file with coordinates for d2i3cb_.
(The format of our PDB-style files is described here.)

Timeline for d2i3cb_: