SCOPe 2.02: Domain d2gzfa_: 2gzf A:

Lineage for d2gzfa_ (2gzf A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family)

5. Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins)

6. Protein ImmE9 protein (Im9) [47351] (1 species)

7. Species Escherichia coli [TaxId:562] [47352] (17 PDB entries)

8. Domain d2gzfa_: 2gzf A: [161446]
   Other proteins in same PDB: d2gzfb_
   automated match to d1e0ha_
   complexed with po4, zn; mutant

Details for d2gzfa_

PDB Entry: 2gzf, 1.75 Å

PDB Description: crystal structure of the e9 dnase domain with a mutant immunity protein im9 (y54f)

PDB Compounds: (A:) colicin-e9 immunity protein

SCOPe Domain Sequences for d2gzfa_:

Sequence; same for both SEQRES and ATOM records:

>d2gzfa_ a.28.2.1 (A:) ImmE9 protein (Im9) {Escherichia coli [TaxId: 562]}
khsisdyteaeflqlvtticnadtsseeelvklvthfeemtehpsgsdlifypkegddds
psgivntvkqwraangksgfkq

Timeline for d2gzfa_:

• d2gzfa_ first appeared in SCOPe 2.01
  
• d2gzfa_ appears in SCOPe 2.03
  
• d2gzfa_ appears in the current release, SCOPe 2.08