Lineage for d1yupe_ (1yup E:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1551687Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1551688Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1551689Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1551712Protein beta-Lactoglobulin [50827] (3 species)
  7. 1551765Species Reindeer (Rangifer tarandus) [TaxId:9870] [141461] (1 PDB entry)
    Uniprot P02755 19-180
  8. 1551767Domain d1yupe_: 1yup E: [161367]
    Other proteins in same PDB: d1yupb_, d1yupc_, d1yupd_, d1yupf_, d1yupg_
    automated match to d1yupa1

Details for d1yupe_

PDB Entry: 1yup (more details), 2.1 Å

PDB Description: reindeer beta-lactoglobulin
PDB Compounds: (E:) beta-lactoglobulin

SCOPe Domain Sequences for d1yupe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yupe_ b.60.1.1 (E:) beta-Lactoglobulin {Reindeer (Rangifer tarandus) [TaxId: 9870]}
dldvqkvagtwyslamaasdislldaqsaplrvyveelkptpggdleillqkwengkcaq
kkiiaekteipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqclvrtpev
ddeamekfdkalkalpmhirlsfnptqleeqcrv

SCOPe Domain Coordinates for d1yupe_:

Click to download the PDB-style file with coordinates for d1yupe_.
(The format of our PDB-style files is described here.)

Timeline for d1yupe_: