Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.1: Biotin repressor-like [46786] (2 proteins) |
Protein Biotin repressor, N-terminal domain [46787] (1 species) the middle domain is an alpha+beta fold somewhat similar to the SH2 fold C-terminal domain has SH3-like common fold |
Species Escherichia coli [TaxId:562] [46788] (4 PDB entries) |
Domain d1biaa1: 1bia A:1-63 [16083] Other proteins in same PDB: d1biaa2, d1biaa3 |
PDB Entry: 1bia (more details), 2.3 Å
SCOPe Domain Sequences for d1biaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} mkdntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgysl pep
Timeline for d1biaa1: