SCOP 1.65: Domain d1du7a1: 1du7 A:2-67

Lineage for d1du7a1 (1du7 A:2-67)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (11 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (3 proteins)

6. Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)

7. Species Escherichia coli [TaxId:562] [46766] (9 PDB entries)

8. Domain d1du7a1: 1du7 A:2-67 [16071]
   Other proteins in same PDB: d1du7a2
   class d; complex with 4-epi-tetracycline
   complexed with ctc; mutant

Details for d1du7a1

PDB Entry: 1du7, 2.51 Å

PDB Description: crystal structure of tet repressor class d with 4-epi-tetracycline

SCOP Domain Sequences for d1du7a1:

Sequence; same for both SEQRES and ATOM records:

>d1du7a1 a.4.1.9 (A:2-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli}
srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdys

Timeline for d1du7a1:

• d1du7a1 first appeared (with stable ids) in SCOP 1.55
  
• d1du7a1 appears in SCOP 1.63
  
• d1du7a1 appears in SCOP 1.67
  
• d1du7a1 last appears in SCOP 1.75