Class a: All alpha proteins [46456] (171 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (11 families) consists only of helices |
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (2 proteins) |
Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species) |
Species Escherichia coli [TaxId:562] [46766] (9 PDB entries) |
Domain d1du7a1: 1du7 A:2-67 [16071] Other proteins in same PDB: d1du7a2 class d; complex with 4-epi-tetracycline complexed with ctc; mutant |
PDB Entry: 1du7 (more details), 2.51 Å
SCOP Domain Sequences for d1du7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1du7a1 a.4.1.9 (A:2-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli} srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila rhhdys
Timeline for d1du7a1: