Lineage for d1msfc1 (1msf C:89-143)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438100Superfamily a.4.1: Homeodomain-like [46689] (13 families) (S)
    consists only of helices
  5. 438260Family a.4.1.3: Myb/SANT domain [46739] (6 proteins)
  6. 438268Protein c-Myb, DNA-binding domain [46740] (1 species)
    duplication
  7. 438269Species Mouse (Mus musculus) [TaxId:10090] [46742] (16 PDB entries)
  8. 438288Domain d1msfc1: 1msf C:89-143 [16041]

Details for d1msfc1

PDB Entry: 1msf (more details)

PDB Description: solution structure of a specific dna complex of the myb dna-binding domain with cooperative recognition helices

SCOP Domain Sequences for d1msfc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1msfc1 a.4.1.3 (C:89-143) c-Myb, DNA-binding domain {Mouse (Mus musculus)}
mlikgpwtkeedqrviklvqkygpkrwsviakhlkgrigkqcrerwhnhlnpevk

SCOP Domain Coordinates for d1msfc1:

Click to download the PDB-style file with coordinates for d1msfc1.
(The format of our PDB-style files is described here.)

Timeline for d1msfc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1msfc2